Glyma02g39230 - SoyBase

SoyBase Follow us on Twitter @SoyBaseDatabase
Integrating Genetics and Genomics to Advance Soybean Research

Report for Sequence Feature Glyma02g39230

Feature Type:	gene_model
Chromosome:	Gm02
Start:	44497249
stop:	44501613
Source:	JGI
Version:	Wm82.a1.v1.1
High confidence:	yes

A newer version of this gene model can be found here:

Annotations for Glyma02g39230

Database ID	Annotation Type	Annotation Description	Annotation Source	Match Score	Evidence Code
AT5G05580	AT	Annotation by Michelle Graham. TAIR10: fatty acid desaturase 8 \| chr5:1664331-1666345 FORWARD LENGTH=435	SoyBase	E_val: 0	ISS
GO:0006629	GO-bp	Annotation by Michelle Graham. GO Biological Process: lipid metabolic process	SoyBase	N/A	ISS
GO:0006633	GO-bp	Annotation by Michelle Graham. GO Biological Process: fatty acid biosynthetic process	SoyBase	N/A	ISS
GO:0009266	GO-bp	Annotation by Michelle Graham. GO Biological Process: response to temperature stimulus	SoyBase	N/A	ISS
GO:0055114	GO-bp	Annotation by Michelle Graham. GO Biological Process: oxidation-reduction process	SoyBase	N/A	ISS
GO:0009507	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast	SoyBase	N/A	ISS
GO:0009941	GO-cc	Annotation by Michelle Graham. GO Cellular Compartment: chloroplast envelope	SoyBase	N/A	ISS
GO:0016717	GO-mf	Annotation by Michelle Graham. GO Molecular Function: oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water	SoyBase	N/A	ISS
GO:0042389	GO-mf	Annotation by Michelle Graham. GO Molecular Function: omega-3 fatty acid desaturase activity	SoyBase	N/A	ISS
PTHR19353	Panther	FATTY ACID DESATURASE 2	JGI		ISS
PF00487	PFAM	Fatty acid desaturase	JGI		ISS
PF11960	PFAM	Domain of unknown function (DUF3474)	JGI		ISS
UniRef100_Q84X83	UniRef	Annotation by Michelle Graham. Best UniRef hit: Microsomal omega-3-fatty acid desaturase n=1 Tax=Glycine max RepID=Q84X83_SOYBN	SoyBase	E_val: 0	ISS
UniRef100_Q84X83	UniRef	Annotation by Michelle Graham. Most informative UniRef hit: Microsomal omega-3-fatty acid desaturase n=1 Tax=Glycine max RepID=Q84X83_SOYBN	SoyBase	E_val: 0	ISS

Proteins Associated with Glyma02g39230

Locus	Gene Symbol	Protein Name
	FAD3b	omega-3-fatty acid desaturase 3 gene 2
	FANX

Expression Patterns of Glyma02g39230

Gene expression representations made with eFP at the University of Toronto.
Waese et al. 2017, Plant Cell 29(8):1806-1821 ePlant: Visualizing and Exploring Multiple Levels of Data for Hypothesis Generation in Plant Biology


Libault et al. 2010, Plant Phys 152(2):541-552. Complete Transcriptome of the Soybean Root Hair Cell, a Single-Cell Model, and Its Alteration in Response to Bradyrhizobium japonicum Infection	Severin et al. 2010, BMC Plant Biology 10:160 RNA-Seq Atlas of Glycine max: A guide to the soybean transcriptome

To see more experiments click HERE

Paralogs of Glyma02g39230

Paralog	Evidence	Comments
Glyma14g37350	IGC	Paralogs in soybean determined by Steven Cannon using BLAST, DAGChainer, PAML, and selection of gene pairs from synteny blocks with median Ks values of less than 0.3.

Gene model name correspondences to Glyma02g39230 Gene Call Version Wm82.a1.v1.1

Corresponding Name	Annotation Version	Evidence	Comments
Glyma.02g227200	Wm82.a2.v1	IGC	As supplied by JGI

References for Glyma02g39230

Schmutz et al. 2010
Genome sequence of the palaeopolyploid soybean
Nature 2010, 463:178-183

Coding sequences of Glyma02g39230

Limit To All Plant Sequences

>Glyma02g39230.1   sequence type=CDS   gene model=Glyma02g39230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
ATGGTTAAAGACACAAAGCCTTTAGCCTATGCTGCCAATAATGGATACCAACAAAAGGGTTCTTCTTTTGATTTTGATCCTAGCGCTCCTCCACCGTTTAAGATTGCAGAAATCAGAGCTTCAATACCAAAACATTGCTGGGTCAAGAATCCATGGAGATCCCTCAGTTATGTTCTCAGGGATGTGCTTGTAATTGCTGCATTGGTGGCTGCAGCAATTCACTTCGACAACTGGCTTCTCTGGCTAATCTATTGCCCCATTCAAGGCACAATGTTCTGGGCTCTCTTTGTTCTTGGACATGATTGTGGCCATGGAAGCTTTTCAGATAGCCCTTTGCTGAATAGCCTGGTGGGACACATCTTGCATTCCTCAATTCTTGTGCCATACCATGGATGGAGAATTAGCCACAGAACTCACCATCAAAACCATGGACACATTGAGAAGGATGAGTCATGGGTTCCATTAACAGAGAAGATTTACAAGAATCTAGACAGCATGACAAGACTCATTAGATTCACTGTGCCATTTCCATTGTTTGTGTATCCAATTTATTTGTTTTCAAGAAGCCCCGGAAAGGAAGGCTCTCACTTCAATCCCTACAGCAATCTGTTTCCACCCAGTGAGAGAAAAGGAATAGCAATATCAACACTGTGTTGGGCTACCATGTTTTCTCTGCTTATCTATCTCTCATTCATAACTAGTCCACTTCTAGTGCTCAAGCTCTATGGAATTCCATATTGGATATTTGTTATGTGGCTGGACTTTGTCACATACTTGCATCACCATGGTCACCACCAGAAACTGCCTTGGTACCGCGGCAAGGAATGGAGTTATTTAAGAGGTGGCCTCACCACTGTGGATCGTGACTATGGTTGGATCAATAACATTCACCATGACATTGGCACCCATGTTATCCACCATCTTTTCCCCCAAATTCCTCATTATCACCTCGTTGAAGCGACACAAGCAGCAAAACCAGTTCTTGGAGATTACTACCGTGAGCCAGAAAGATCTGCGCCATTACCATTTCATCTAATAAAGTATTTAATTCAGAGTATGAGACAAGACCACTTCGTAAGTGACACTGGAGATGTTGTTTATTATCAGACTGATTCTCTGCTCCTCCACTCGCAACGAGACTGA

Predicted protein sequences of Glyma02g39230

Limit To All Plant Sequences

>Glyma02g39230.1   sequence type=predicted peptide   gene model=Glyma02g39230   sequence assembly version=Glyma 1.0   annotation version=1.1   JGI Gene Call confidence=high
MVKDTKPLAYAANNGYQQKGSSFDFDPSAPPPFKIAEIRASIPKHCWVKNPWRSLSYVLRDVLVIAALVAAAIHFDNWLLWLIYCPIQGTMFWALFVLGHDCGHGSFSDSPLLNSLVGHILHSSILVPYHGWRISHRTHHQNHGHIEKDESWVPLTEKIYKNLDSMTRLIRFTVPFPLFVYPIYLFSRSPGKEGSHFNPYSNLFPPSERKGIAISTLCWATMFSLLIYLSFITSPLLVLKLYGIPYWIFVMWLDFVTYLHHHGHHQKLPWYRGKEWSYLRGGLTTVDRDYGWINNIHHDIGTHVIHHLFPQIPHYHLVEATQAAKPVLGDYYREPERSAPLPFHLIKYLIQSMRQDHFVSDTGDVVYYQTDSLLLHSQRD*

Funded by the USDA-ARS. Developed by the USDA-ARS SoyBase and Legume Clade Database group at the Iowa State University, Ames, IA

U.S. Public Domain